PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00004939-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB
Protein Properties Length: 497aa    MW: 54787.4 Da    PI: 5.7812
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00004939-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.6e-184087148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT  Ed +lv++vk++G g+W+++ ++ g+ R++k+c++rw ++l
  WALNUT_00004939-RA 40 KGPWTSAEDAILVEYVKKHGEGNWNAVQKHSGLSRCGKSCRLRWANHL 87
                        79******************************************9986 PP

2Myb_DNA-binding49.78.2e-1693136146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         +g++T+eE+  ++++++++G++ W++ a++++ gRt++++k++w++
  WALNUT_00004939-RA  93 KGAFTPEEEHHIIELHAKMGNK-WARMAAELP-GRTDNEIKNYWNT 136
                         799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.7663587IPR017930Myb domain
SuperFamilySSF466897.49E-3138134IPR009057Homeodomain-like
SMARTSM007176.1E-163989IPR001005SANT/Myb domain
PfamPF002494.8E-164087IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-244194IPR009057Homeodomain-like
CDDcd001671.06E-114387No hitNo description
PROSITE profilePS5129424.74988142IPR017930Myb domain
SMARTSM007171.0E-1392140IPR001005SANT/Myb domain
PfamPF002495.2E-1593136IPR001005SANT/Myb domain
CDDcd001677.55E-1095136No hitNo description
Gene3DG3DSA:1.10.10.601.9E-2595140IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MKGTTNKSEN KKMSKGNCDL VSVEEAKVGG NLGGGGPLKK GPWTSAEDAI LVEYVKKHGE  60
GNWNAVQKHS GLSRCGKSCR LRWANHLRPD LKKGAFTPEE EHHIIELHAK MGNKWARMAA  120
ELPGRTDNEI KNYWNTRIKR LQRSGTPIYP PDVCFQLMNG SEDDHMGTLP IGDTHHHDLL  180
QGDSIEIPFV ELNNLLNSGY LSYSPKFLDI PPSSMLRQGV SSSHTYDLLF PTMHPPKRFR  240
ESETLFPGLD GSVSSALPVF NHYMDYTCDL KAAETLNFSS SFDQDLNTND QLPFGGLSGS  300
HALLNGNSSS SEPISGAMKL ELPSLQYSET QPGSWGKLAS PLPSLESVDT LIQSPPTEQT  360
HSDCLSPRSS GLLEAILYES RTLKDSRNNP PRETLDISVM PDVKKRSSMN PCGTDGDPNS  420
PLGHSAASVF SEYTPVSGSS IDEHQLVEFM LGCDAMPETV DQDPSHYLVK KEISSLIDFS  480
RPDALLDLCW FGHRNDF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-32381405106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012075987.10.0PREDICTED: transcription factor GAMYB-like
SwissprotQ0JIC21e-111GAM1_ORYSJ; Transcription factor GAMYB
TrEMBLA0A067KE640.0A0A067KE64_JATCU; MYB family protein
STRINGPOPTR_0009s02380.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-90myb domain protein 33